Live Job Feed

Find Your Dream Career

Thousands of curated opportunities from top companies — filter by role, salary, and remote preference to find your perfect fit.

Free foreverNo credit card requiredVerified listings
1,382+
Live Positions
Companies
100%
Free to Apply
Updated Hourly
Fresh Listings
Quick:
Browse:

1,382 jobs

CRO Manager - E-Commerce (m/w/d) in Vollzeit
Full TimeOn-siteMid
javascriptfigmaseoonboarding

🚀 Globalist ist DIE führende Performance-Marketing-Agentur für nationale und internationale digitale Marketingstrategien, made in Stuttgart! Unsere Agentur ist in Paid Search, Paid Social und Organic Search unterteilt und betreut bereits über 370 Kunden. Wir verwalten jährlich 60 Mio. € Werbebudget und kombinieren Strategie mit operativer Skalierungsexpertise. Dank direkter Google- und Meta-Schulungen setzen wir auf moderne, datengetriebene Performance-Optimierung. Zu unseren Kunden gehören Boehringer Ingelheim, La Marzocco, Nø Cosmetics, ASAM BEAUTY und viele mehr! Was uns unterscheidet: Unser Herz schlägt für den eCommerce. Wir betreuen nicht nur Top-Brands, sondern betreiben auch eigene eCommerce-Shops. Das bedeutet, du kannst dich über das reine Design hinaus in Bereichen wie Nutzerforschung, datengetriebene Optimierung und Shopify-Ökosysteme weiterentwickeln und die Ergebnisse deiner Arbeit direkt an echten Umsatzzahlen messen. Aufgaben Als CRO Manager bei Globalist optimierst du E-Commerce-Shops so, dass aus Besuchern Käufer werden – datenbasiert, hypothesengetrieben und mit direktem Impact auf den Umsatz unserer Kunden. Du bist die Schnittstelle zwischen Daten, Design und Entwicklung und steuerst CRO-Projekte von der Analyse bis zur Umsetzung. Das erwartet dich konkret bei uns: Du analysierst Conversion Funnels, Nutzerverhalten und Shop-Performance unserer E-Commerce-Kunden mit GA4, Heatmap-Tools und Session Recordings – und leitest daraus konkrete Optimierungshypothesen ab. Du konzipierst A/B-Tests und Personalisierungsmaßnahmen, priorisierst sie nach Uplift-Potenzial und begleitest den gesamten Testing-Prozess bis zur statistisch validen Auswertung. Du übernimmst das Stakeholder Management gegenüber unseren Kunden: Du präsentierst Testergebnisse, erklärst komplexe CRO-Zusammenhänge verständlich und leitest klare Handlungsempfehlungen ab. Du erstellst Wireframes und klickbare Prototypen in Figma, um Optimierungsideen schnell greifbar zu machen – für Kunden, Entwickler und interne Teams. Du arbeitest eng mit Webentwicklern zusammen und bringst grundlegendes technisches Verständnis (HTML/CSS, JavaScript-Basics) mit, um Umsetzungen zu begleiten und zu prüfen. Du arbeitest crossfunktional mit unseren SEA-, Paid-Social- und SEO-Teams, um kanalübergreifende Optimierungspotenziale zu identifizieren und gemeinsam zu heben. Qualifikation Das bringst du mit (Muss): 2–3 Jahre Berufserfahrung im Bereich CRO, E-Commerce oder UX – idealerweise in einer Agentur oder einem E-Commerce-Unternehmen Nachweisbare Erfahrung im E-Commerce: Du kennst typische Funnel-Strukturen, weißt, wo Shops verlieren und was Conversion-Hebel im Online-Handel sind Sicheres Stakeholder Management: Du kannst Testergebnisse und Optimierungsstrategien gegenüber Kunden klar kommunizieren und überzeugend vertreten Sicherer Umgang mit Figma – du kannst Hypothesen in Wireframes und Prototypen übersetzen, ohne auf Entwickler warten zu müssen Grundlegendes technisches Verständnis (HTML/CSS, JavaScript-Basics), um mit Entwicklern auf Augenhöhe zu kommunizieren und Implementierungen zu prüfen Erfahrung mit A/B-Testing-Tools (z.B. VWO, Optimizely, AB Tasty) und Google Analytics / GA4 Fließende Deutschkenntnisse (C1) für die direkte Kundenberatung Das wäre das Sahnehäubchen (Kann): Erfahrung mit Heatmap- und Session-Recording-Tools wie Hotjar oder Microsoft Clarity Kenntnisse in Shopify, Shopware oder anderen E-Commerce-Systemen Interesse an AI-gestützter Optimierung und GEO (Generative Engine Optimization) Benefits Bei Globalist arbeitest du in einem crossfunktionalen Team, das Performance nicht nur für Kunden denkt, sondern auch für sich selbst lebt. CRO ist bei uns kein Silo – du arbeitest täglich mit SEA-, SEO- und Paid-Social-Experten zusammen und profitierst von einem breiten Wissenspool. Learnings werden offen geteilt, Testergebnisse gemeinsam gefeiert. Unsere eigenen E-Com-Brands im Fashion- und Outdoor-Bereich dienen dir als Playground: Neue Hypothesen testen, bevor sie auf Kundenprojekte skaliert werden. Dein Arbeitsalltag: Flexible Arbeitszeiten 🕗 Modernes Office direkt in der Stuttgarter Innenstadt mit Dachterrasse ☀️ Höhenverstellbare Tische und eigenes MacBook bei Festanstellung 💻 Deine Entwicklung: Regelmäßige Weiterbildungsmöglichkeiten und langfristige Karriereperspektive 🎓 Einblicke über CRO hinaus – Supply Chain, Product Development, Shop-Systeme und Paid Marketing Regelmäßige Feedbackgespräche, damit du dein volles Potenzial ausschöpfen kannst Deine Extras: Kostenloses DB-Deutschlandticket oder Parkplatz in der Innenstadt 🚗 E-Gym Wellpass für deine Fitness und Gesundheit 🏋🏽 Kostenlose Getränke und Kaffee im Office 🥤 Regelmäßige Firmenveranstaltungen und Teamevents 🍾 Für uns selbstverständlich: Großartiger Team-Spirit und wertschätzende Atmosphäre 😊 Flache Hierarchien und kurze Entscheidungswege Strukturiertes Onboarding ab Tag 1 👋 Klingt nach dir? Dann freuen wir uns auf deine Bewerbung – gerne mit konkreten Beispielen oder Cases, die zeigen, wie du Conversion Rates im E-Commerce messbar verbessert hast. 📍 Es handelt sich hierbei um keine Remote-Stelle! Find more English Speaking Jobs in Germany on Arbeitnow

View Job
Werkstudent Software-Testing (m/w/d)
NEW

Werkstudent Software-Testing (m/w/d)

functionHR GmbHMunich (Fully Remote)12 hours ago
Full TimeFully RemoteMid
javascripttypescriptplaywrightfigmamachine learninggitlab+1

functionHR ist ein Spin-Off der LMU München. Wir entwickeln eine innovative und preisgekrönte Softwarelösung für Mitarbeiterbefragungen und People Analytics. Damit begleiten wir Unternehmen auf ihrem Weg zum datengestützten Personalmanagement. Durch die Verbindung von Statistik, Machine Learning und künstlicher Intelligenz mit innovativen Web-Anwendungen revolutionieren wir die Art und Weise, wie HR-Entscheidungen in Unternehmen getroffen werden. Zu unseren Kunden zählen namhafte Unternehmen verschiedener Branchen und Größen. Aufgaben Unterstützung im Software-Testing Du erstellst Testpläne und wirst Experte für unsere Software-Applikationen. Du führst manuelle Tests neuer Features durch, dokumentierst Fehler und erstellst Bug-Tickets. Du unterstützt bei Release- und Regressionstests und hilfst so, unsere Software stabiler zu machen. Unterstützung im Schreiben von E2E-Tests und Test-Automatisierung Du identifizierst Testfälle, die sich für eine Automatisierung eignen. Mit Unterstützung unserer Entwickler erstellst und pflegst Du E2E-Tests mit Playwright. Du analysierst Testergebnisse und hilfst dabei, die Testabdeckung kontinuierlich zu verbessern. Weiterentwicklung des Produktes Du identifizierst Optimierungspotential in der Usability unserer Software Du stehst im engen Austausch mit dem Product Owner, Customer Success Managern und der Entwicklung Qualifikation Studiengang im Bereich Informatik, Wirtschaftsinformatik oder ein vergleichbarer Studiengang oder eine entsprechende Berufsausbildung Grundlegende Programmierkenntnisse sind ein Muss Erste Erfahrungen mit JavaScript/TypeScript oder Testautomatisierung sind von Vorteil Gute Kommunikationsfähigkeiten in Deutsch und Englisch (in Wort und Schrift) Eigenständigkeit und eine strukturierte Arbeitsweise mit einem Auge fürs Detail Motivation und Neugierde für neue Themengebiete Benefits Erfahrenes, motiviertes und eingespieltes Team von Entwicklern und Data Scientists Große Flexibilität bezüglich Arbeitszeiten und Arbeitsort – 100% Remote möglich (Dt. Wohnsitz nötig) EGYM Wellpass mit geringem Eigenanteil Spannende Einblicke in international tätige Unternehmen aller Größen und die Möglichkeit echte Wirkung auf Entscheidungsprozesse bei Kunden zu erzielen Flache Hierarchien und viel Entscheidungsfreiheit Modernes Toolset – GitLab, Figma & Co. für effiziente Zusammenarbeit Moderne Hardwareausstattung Regelmäßige Team-Events – auch remote bleiben wir connected Bitte schreibe uns in ein, zwei Sätzen deine Motivation, bei functionHR zu arbeiten. Gebe uns bitte deinen möglichen Starttermin sowie deine Gehaltswünsche (Stundenlohn) an. Find Jobs in Germany on Arbeitnow

View Job
social media specialist
Full TimeOn-siteMidCA$48,000 - CA$60,000 / Year
dentalgraphic designdigital marketingsocial media marketingemail marketingklaviyo+1

*Job Summary* Are you looking for a career change? Turnabout is looking for a creative, fashion-forward Social Media Specialist to help shape and grow our social media presence. In this role, you?ll work collaboratively with the Marketing Director to develop and execute engaging content, images, customer adoption campaigns and social media strategies that bring the Turnabout brand to life. The ideal candidate has a genuine passion for fashion, hands-on experience with digital and influencer marketing, and a strong eye for visual content. Strong graphic design skills using Canva or Adobe are preferred, along with the confidence and personality to be comfortable on camera and create engaging video content. You?ll play a key role in increasing brand awareness, showcasing what makes Turnabout unique, and connecting with a broad and growing audience across social platforms. This is an exciting opportunity for someone who loves fashion, thrives in a fast-paced environment, and wants to combine creativity, strategy, and storytelling to make an impact. *What we offer:* * Competitive wages depending of experience * On demand pay * RRSP matching Program * Extended Benefits * Ongoing fashion education * Ongoing professional development * Work with teams that enjoy and support each other * 50% Consignment split *If you:* * Have a bachelor's degree in Marketing, Social Media, a related field, or evidence of exceptional ability. * Have a passion for the sustainable luxury fashion and consignment industry. * Minimum of 3+ years of social media experience managing all major social platforms (not personal accounts) * Strong digital marketing skills in social media. * Email marketing experience (Klaviyo preferred). * Data-driven mindset with a strong analytical and problem-solving skill set. * Excellent communication and interpersonal skills. * Creative thinker with the ability to generate innovative marketing ideas. *What you?ll do:* * Collaboratively develop and execute social media marketing strategies for brand growth and customer retention. * Plan, organize, and execute campaigns, promotions, and events. * Execute and manage seasonal photoshoots with our in-house photographer and stylist. * Ensure User-Generated Content (UGC) is utilized effectively. * Participate in in-house and externally sponsored Turnabout events. * Ensure social media customer inquiries are answered in a timely fashion. * Maintain consistent branding across all channels. * Use data for targeted marketing decisions. * Seek strategic partnerships for brand expansion. * Track and report on marketing performance. * Work weekends or evenings as required. *Who we are:* Turnabout began in 1978 and is an industry leader in the resale of contemporary and designer clothing & accessories for women and men with eight brick & mortar stores that stretch from Vancouver to South Surrey and Oak Bay in Victoria. The diversity, talent, and accomplishments of our consignors & shoppers offer a great opportunity to work with amazing clients that buy and sell quality clothing & accessories brought to us from all over the world. You will learn all the facets of retail and our industry, and be part of a sustainable business that supports the community. *How to Apply:* Interested candidates are invited to submit their resume, a cover letter detailing their relevant experience, and why they are a great fit for this role. Sending a portfolio is highly preferred and encouraged Pay: $48,000.00-$60,000.00 per year Benefits: * Dental care * Flexible schedule * RRSP match Work Location: In person

View Job
manager, marketing
Full TimeOn-siteMidCA$60,000 - CA$100,000 / Year
javascriptsqlproject managementgraphic designadobe photoshopcontent creation+7

*Overview* We are seeking a dynamic and innovative *Marketing Manager* to lead our marketing initiatives and drive brand growth across multiple channels. This energetic role offers the opportunity to craft compelling campaigns, optimize digital presence, and analyze market trends to ensure our brand remains at the forefront of the industry. As a key member of our team, you will develop strategic marketing plans, oversee content creation, and leverage data-driven insights to maximize engagement and ROI. If you thrive in a fast-paced environment and are passionate about digital marketing, this is your chance to make a significant impact! *Duties* * Develop and execute comprehensive marketing strategies that align with company goals, focusing on digital channels such as social media, email marketing, and paid advertising campaigns. * Manage and optimize e-commerce platforms, ensuring seamless user experience and high conversion rates through SEO best practices and website enhancements using WordPress, HTML, CSS, and JavaScript. * Lead keyword research efforts to identify high-performing keywords for SEO and PPC campaigns; utilize Google Ads, Google AdWords, Facebook Advertising, and Google Analytics to monitor performance metrics. * Design engaging visual content using Adobe Photoshop, Adobe Creative Suite, and graphic design principles to support campaigns across various platforms. * Conduct market research and analyze consumer behavior data with SQL and Google Analytics to inform campaign strategies and improve targeting accuracy. * Oversee email marketing initiatives by creating compelling content, segmenting audiences effectively, and analyzing campaign results for continuous improvement. * Collaborate with cross-functional teams to ensure cohesive branding; manage content updates on WordPress websites while maintaining technical SEO standards. *Qualifications* * Proven experience in digital marketing with a strong understanding of e-commerce platforms and online advertising tools. * Proficiency in SEO techniques, keyword research, Google Ads/AdWords management, Google Analytics, Facebook Advertising, and email marketing platforms. * Skilled in graphic design software such as Adobe Photoshop and Adobe Creative Suite; familiarity with HTML, CSS, JavaScript for website optimization. * Knowledge of SQL for data analysis; experience with analytics tools to interpret campaign performance metrics. * Strong understanding of digital marketing strategies including content creation, social media management, PPC campaigns, and conversion optimization. * Excellent communication skills with the ability to translate data insights into actionable plans; highly organized with project management capabilities. Join us as we innovate in the digital space! Bring your expertise in *digital marketing*, *SEO*, *graphic design*, and *analytics* to help elevate our brand presence globally. We value energetic professionals who are eager to learn, grow their skills continuously, and contribute to our vibrant team environment! Pay: $60,000.00-$100,000.00 per year Work Location: In person

View Job
sourcing specialist
NEW

sourcing specialist

CDPAncaster, Canada9 hours ago
Full TimeOn-siteMidCA$45,760 - CA$49,920 / Year
javascriptsqlgraphic designadobe photoshopdigital marketingseo+4

*Overview* Join our dynamic team as a Part-Time Amazon Marketplace Specialist and become a vital driver of our e-commerce success! In this role, you will leverage your expertise in digital marketing, product listing optimization, and data analysis to enhance our presence on Amazon?s marketplace. Your energetic approach will help us elevate our brand visibility, improve sales performance, and deliver exceptional customer experiences. This position offers a flexible schedule for motivated individuals eager to grow their skills in a fast-paced online retail environment. *Responsibilities* * Manage and optimize product listings on Amazon, ensuring accurate descriptions, compelling images, and relevant keywords to maximize visibility and sales. * Conduct comprehensive keyword research using tools like Google Ads, Google Analytics, and specialized SEO software to identify high-impact search terms. * Implement SEO best practices to improve organic rankings and drive targeted traffic to our Amazon storefront. * Monitor marketplace performance metrics such as sales trends, customer reviews, and product rankings; analyze data using SQL and Google Analytics to identify opportunities for growth. * Coordinate with graphic design tools like Adobe Photoshop and Adobe Creative Suite to create engaging product images and promotional content. * Utilize HTML, CSS, JavaScript, and WordPress skills to update product pages or landing pages as needed for enhanced user experience. * Develop and execute digital marketing campaigns across platforms including Facebook Advertising, Google AdWords, and Email marketing to boost product visibility. * Track advertising performance metrics; optimize campaigns using insights from Google Ads and Facebook Advertising tools for better ROI. * Maintain detailed records of marketplace activities, inventory updates, and promotional efforts to ensure seamless operations. *Requirements* * Proven experience in e-commerce management with a focus on Amazon marketplace operations. * Strong understanding of SEO strategies, keyword research techniques, and digital marketing channels such as Google Ads, Facebook Advertising, and Email marketing. * Familiarity with analytics tools like Google Analytics and SQL for data-driven decision-making. * Ability to perform keyword research effectively using industry-standard tools. * Excellent communication skills combined with a proactive attitude toward learning new skills in digital marketing and e-commerce trends. Embark on this exciting journey with us! We?re passionate about empowering our team members to thrive in the ever-evolving world of online retail while enjoying the flexibility of part-time work that fits your lifestyle. Pay: $22.00-$24.00 per hour Work Location: Hybrid remote in Ancaster, ON

View Job
For Employers

Reach — qualified candidates

Post your job today and get applications within 24 hours.

Post a JobFree posting available
Senior Product Manager — AI & Data Security

Senior Product Manager — AI & Data Security

ForcepointGreater Richmond Region, United States5 days ago
Full TimeOn-siteMid
gofigmazero trustremediationintellectual propertycompetitive analysis+3

Who is Forcepoint? Forcepoint simplifies security for global businesses and governments. Forcepoint's all-in-one, truly cloud-native platform makes it easy to adopt Zero Trust and prevent the theft or loss of sensitive data and intellectual property no matter where people are working. 20+ years in business. 2.7k employees. 150 countries. 11k+ customers. 300+ patents. If our mission excites you, you're in the right place; we want you to bring your own energy to help us create a safer world. All we're missing is you! Forcepoint is seeking a Senior Product Manager to drive roadmap and execution in our Data Security Posture Management and AI Security product line. This role is the critical nexus between engineering, design, go-to-market, and customer-facing teams, driving the full product lifecycle from discovery through market adoption. The ideal candidate combines deep technical fluency in data security with a hands-on, customer-obsessed approach to product management. You will engage directly with security architects, and enterprise buyers while also rolling up your sleeves on PRDs, Figma reviews, sprint planning, and competitive analysis. This is an execution biased role; we need someone equally comfortable presenting to customers and unblocking detailing out requirements as part of an engineering sprint. Key Responsibilities Product Strategy & Roadmap Define and own the parts of the product vision, strategy, and multi-quarter roadmap for Forcepoint's DSPM and AI Security working in a high-performance team of other PMs. Conduct continuous competitive intelligence to inform positioning and feature prioritization. Good understanding of the jobs to be done framework and ability to translate customer needs into well-defined workflows leading to measurable security outcomes for customers. Translate market trends, customer insights, and regulatory reqinto actionable product initiatives. Drive data-driven prioritization using product telemetry, win/loss analysis, and customer usage analytics. Product Execution Engage deeply with engineering on data discovery, classification engines, policy models, APIs, and remediation workflows. Author detailed PRDs, user stories, and acceptance criteria that engineering teams can execute against with minimal ambiguity. Drive the discover-classify-assess-remediate lifecycle across structured and unstructured data stores, SaaS applications, and cloud-native environments. Partner with UX/UI to transform complex DSPM workflows into intuitive, modern interfaces Synthesize complex feedback from field teams (Sales, Solutions Engineers, Customer Success) into structured problem statements and prioritized requirements. Support go-to-market teams with competitive positioning, demo narratives, and roadmap communications. Required Experience Product Management experience in B2B/enterprise software, with progressive ownership of product areas. Experience in Cyber security, data protection, or cloud infrastructure products. Proven track record of owning a product or major feature area end-to-end: strategy, roadmap, delivery milestones, and adoption. Hands-on domain expertise in one or more of the following (multiple strongly preferred): Data Security / DLP (across endpoints, cloud, email, web, or networks) DSPM (data discovery, classification, posture assessment, remediation in cloud data stores) Cloud Security Platforms (CSPM/SSPM/CASB) with emphasis on data or identity components Don't meet every single qualification? Studies show people are hesitant to apply if they don't meet all requirements listed in a job posting. Forcepoint is focused on building an inclusive and diverse workplace – so if there is something slightly different about your previous experience, but it otherwise aligns and you're excited about this role, we encourage you to apply. You could be a great candidate for this or other roles on our team. The policy of Forcepoint is to provide equal employment opportunities to all applicants and employees without regard to race, color, creed, religion, sex, sexual orientation, gender identity, marital status, citizenship status, age, national origin, ancestry, disability, veteran status, or any other legally protected status and to affirmatively seek to advance the principles of equal employment opportunity. Forcepoint is committed to being an Equal Opportunity Employer and offers opportunities to all job seekers, including job seekers with disabilities. If you are a qualified individual with a disability or a disabled veteran, you may request a reasonable accommodation if you are unable or limited in your ability to use or access the Company's career webpage as a result of your disability. You may request reasonable accommodations by sending an email to recruiting@forcepoint.com . Applicants must have the right to work in the location to which you have applied.

View Job
Product Manager
NEW

Product Manager

ShiptBirmingham, United States20 hours ago
Full TimeOn-siteMid
figmasqldata sciencedentalcapartnerships+3

Impact As a Product Manager on the Order Fulfillment team, you'll be at the forefront of shaping Shopper app fulfillment solutions for drivers and shoppers—owning the intake, planning, and execution for new product features, enhancements, and defect resolution. This role sits at the intersection of technology, data science, economics, and operations, focused on ensuring a reliable fulfillment quality across the marketplace. You will drive products to optimize fulfillment quality and strengthen shopper's connections with Shipt customers. We are looking for a highly creative and execution-oriented PM who thrives in ambiguity, makes strategic product decisions grounded in data, and moves with a strong bias for action. You may work on complex product areas such as gig worker onboarding experiences, order fulfillment & delivery tooling, earnings & goal tracking, and engagement & retention programs. What You'll Need to Be Successful 3+ years of product management experience in logistics, retail, gig, or related field Proven experience in demonstrating AI-native mindset with hands-on use of generative AI to rapidly prototype ideas, automate repetitive workflows, synthesize insights from unstructured data, and improve decision-making. Comfortable using modern AI-assisted development practices (e.g., spec-driven development, AI coding assistants, and agentic workflows) to accelerate product discovery and execution. A history of strong partnerships with design and engineering, with a general understanding of design and development systems and processes Demonstrate a high level of empathy and storytelling capability to influence a large network of stakeholders and customers. Technical expertise and the ability to make informed trade-offs between various system architectures. Experience with SQL, Figma, Miro, ClickUp, or equivalent Skills & Education This list includes key skills used in this job but is not inclusive of all skills needed for the role. Please see any required education below. AI, Collaboration, Logistics, Product Management, SQL Work Arrangement To foster connection while offering continued flexibility, hybrid team members have the following in-office expectations: Hybrid roles in Birmingham, AL typically work in-office at least 2 days per week, with core in-office days on Wednesdays and Thursdays. Hybrid roles in Minneapolis, MN typically work in-office at least 1 day per week on either Tuesday, Wednesday, or Thursday. Hybrid roles in San Francisco, CA typically work in-office at least 1 day per week between Monday and Thursday. Certain roles may require in-office presence on a full-time basis. Please work with your recruiter to learn more about the classification of this role. About Shipt Shipt is a retail tech company that connects people to reliable, high-quality delivery with a personal touch. Shipt connects customers to the things they want from the stores they love, retail businesses to more satisfied customers, and workers to new earning opportunities. At Shipt, we aim to put our team first to boost a sense of belonging, spark opportunities for growth, provide unique benefits and commit to giving back to our communities in ways that make life better, both personally and professionally. We understand that our service, our culture, and our connection to our communities are only made better by every single person who shows up to work here every day. Learn More. Shipt is an independently operated, wholly owned subsidiary of Target Corporation and available in more than 5,000 U.S. cities. Shipt was founded and is headquartered in Birmingham, Alabama. For more information, please visit Shipt's company site at Shipt.com. We are an equal opportunity employer and value diversity at our company. We do not discriminate on the basis of race, color, national origin, ethnicity, religion or religious belief, sex (including pregnancy, childbirth, or related medical conditions), sexual orientation, gender, gender identity, gender expression, transgender status, sexual stereotypes, age, military or veteran status, disability, or any other characteristic protected by law. Please inform your recruiting contact upon initial connection if you need a reasonable accommodation. If you need assistance filling out a job application, please complete this form. Pursuant to the San Francisco Fair Chance Ordinance, we will consider for employment qualified applicants with arrest and conviction records. Employees (and eligible family members) are covered by medical, dental, vision and more. Employees may enroll in our company's 401k plan. Employees will also be eligible to receive discretionary vacation for exempt team members, paid holidays throughout the calendar year and paid sick leave. Other compensation includes eligibility for an annual bonus and the potential for restricted stock units based on role.

View Job
Pflichtpraktikum im Bereich Grafikdesign (m/w/d)
Full TimeOn-siteMid
rillustratorindesignaccount managementr

Wir suchen dich für ein spannendes Praktikum im Grafikdesign , um unser Team bei der Entwicklung kreativer und ansprechender Designs für unsere Kunden zu unterstützen. Du wirst visuelle Konzepte für verschiedene Kanäle gestalten und dafür sorgen, dass die Marken unserer Kunden auf Plattformen wie Amazon überzeugend präsentiert werden. Dabei entwickelst du individuelle Grafiken und Layouts, optimierst bestehende Designs und arbeitest eng mit internen Teams sowie Kunden zusammen, um ihre Vorstellungen professionell umzusetzen. Aufgaben Amazon-Design: Unterstützung bei der Erstellung von visuellen Inhalten für Amazon, einschließlich Produktbildern, A+ Content, Werbebannern und Infografiken zur Optimierung der Conversion-Rate. Markenidentität: Mitwirkung bei der Entwicklung und Pflege konsistenter Markenidentitäten für unsere Kunden durch kreative und innovative Designkonzepte. Optimierung: Zusammenarbeit mit dem Account Management und dem Performance Marketing Team, um sicherzustellen, dass die Designs strategische Ziele unterstützen und die Sichtbarkeit auf Amazon erhöhen. Trendbeobachtung: Aktive Recherche von Design Trends und Best Practices, um stets aktuelle und relevante Designs für Amazon zu liefern‍. Feedback-Management: Anpassung von Designs basierend auf Kundenfeedback und den spezifischen Anforderungen der Plattform. Qualifikation Studium: Du bist immatrikulierte/r Student/in im Bereich Grafikdesign oder einem verwandten Studiengang. Kreativität: Du bringst ausgeprägte kreative Fähigkeiten mit und hast erste praktische Erfahrungen im Grafikdesign, idealerweise ergänzt durch ein Portfolio, das deine Arbeiten zeigt. Technische Kenntnisse: Du bist sicher im Umgang mit gängigen Grafik Design-Programmen wie Adobe Creative Suite (Photoshop, Illustrator, InDesign). Kommunikationsstärke: Gute mündliche und schriftliche Kommunikationsfähigkeiten in Deutsch und Englisch, um Ideen und Konzepte klar zu präsentieren. Detailorientierung: Hohe Aufmerksamkeit für Details und die Fähigkeit, qualitativ hochwertige Designs unter Einhaltung von Deadlines zu liefern.‍ Interesse an E-Commerce: Grundkenntnisse über Plattformen wie Amazon und deren Anforderungen an Design sind von Vorteil. Benefits Hybrides Arbeitsmodell: Kombination aus Home Office und Büroarbeit für mehr Flexibilität. Kreative Freiräume: Raum für eigene Ideen und innovative Projekte im Bereich Grafikdesign. Weiterentwicklungsmöglichkeiten: Zugang zu Schulungen und Workshops, um deine Design-Fähigkeiten auszubauen. Teamkultur: Ein unterstützendes und kreatives Team mit offener Kommunikationskultur.‍ Moderne Ausstattung: Du arbeitest mit professionellen Tools und der neuesten Design-Software. Überzeuge dich selbst und mache einen Abstecher zu unserer letzten Workation in Portugal: https://www.youtube.com/watch?v=dXcSIfU1zKw Hier geht's zu unseren Social Media Accounts: LinkedIn eFLY: https://www.linkedin.com/company/66918950/ LinkedIn Moritz: https://www.linkedin.com/in/moritz-heller-ab1310183/ Wir freuen uns auf Dich! 🤗 Find more English Speaking Jobs in Germany on Arbeitnow

View Job
Software Engineer, Infrastructure ($140K–$215K + Equity) at Opal Security
Full TimeOn-siteMid
gofigmaawsgcpcloudflareterraform+7

This is a job that Jill, our AI Recruiter, is recruiting for on behalf of one of our customers. She will pick the best candidates from Jack's network. The next step is to speak to Jack. Job Title Software Engineer, Infrastructure Salary $140K–$215K + Equity Company Description Opal Security is a $59M venture-backed security leader building AI-native identity governance, supported by premier investors like Greylock and Battery. Job Description Join Opal Security to architect and scale critical infrastructure for AI-native security. You will own the platform's stability across Kubernetes, Golang, and Terraform, supporting both cloud and self-hosted environments. Collaborate directly with engineers at industry leaders like Figma and Databricks to build the next generation of identity management tools. Location San Francisco, USA Why this role is remarkable Direct impact on security infrastructure for category-defining companies like Databricks, Figma, and Cloudflare. Backed by $59M from top-tier investors Greylock and Battery, led by experts from Dropbox and the intersection of math and crypto. High-growth environment with a seat at the table for product decisions and the creative freedom to architect complex multi-cloud solutions. What You Will Do Design and scale critical infrastructure using Kubernetes, Golang, and Terraform across AWS, GCP, and self-hosted customer environments. Architect systems that ensure platform stability, security, and speed, enabling product engineers to ship features with high confidence. Consult directly with security and engineering teams at Fortune 500 startups to understand and solve their complex IAM challenges. The ideal candidate Strong background in infrastructure engineering with deep expertise in Golang, Kubernetes, and managing distributed systems at scale. Experienced in infrastructure-as-code using Terraform and proficient in managing cloud-native databases like Postgres and Redis. Proactive problem-solver who enjoys working across the stack and collaborating with both internal teams and external enterprise customers. Who are Jack & Jill? Ok, I'll go first. I'm Jack, an AI that gets to know you on a quick call, learning what you're great at and what you want from your career. Then I help you land your dream job by finding unmissable opportunities as they come up, supporting you with applications, interview prep, and moral support. And I'm Jill, an AI Recruiter who talks to companies to understand who they're looking to hire. Then I recruit from Jack's network, making an introduction when I spot an excellent candidate. How does this work? Jack's an AI agent for job searching and career coaching. He works for you. Jill is the AI recruiter working for the company. She recruits from Jack's network. If it's a match and the company wants to meet you, they'll make the intro. In the meantime, if you'd like, Jack will send you excellent alternatives. We never post fake jobs This isn't a trick. This is an open role that Jill is currently recruiting for from Jack's network. Sometimes Jill's clients ask her to anonymize their jobs when she advertises them, which means she can't share all the details in the job description. We appreciate this can make them look a bit suspect, but there isn't much we can do about it. Give Jack a spin! You could land this role. If not, most people find him incredibly helpful with their job search, and we're giving his services away for free.

View Job
Product Designer
NEW

Product Designer

AMBOSSBerlin, Germany19 hours ago
Full TimeOn-siteMid
gofigmarestclinicalarchitecturevisual design+6

Hi! We are AMBOSS and we are looking for a Product Designer to join our Education team in Berlin. In this individual contributor role, you will help shape learning experiences that support medical students and professionals as they prepare for career-defining exams and continue learning throughout their careers. About AMBOSS AMBOSS is a dynamic learning and clinical decision support tool committed to empowering medical professionals globally to deliver optimal care. Since our inception in 2012, we've harnessed cutting-edge technology to transform the way physicians acquire and apply scientific knowledge. Each AMBOSSian is passionate about being the champion of clinicians today - this motivates and unites us each day towards success. And what does success look like? When a clinician or med student tells us, "AMBOSS makes practicing medicine easier and enjoyable. I love what I do, and a big part is because of AMBOSS." Why can this role be exciting for you? You will shape the end-to-end exam preparation experience, with a focus on our Qbank product. Your work will help medical learners globally, to practice more effectively, close knowledge gaps, simulate real exam conditions, and benefit from personalized, AI-powered learning experiences, directly supporting AMBOSS's mission to empower healthcare professionals. Working in a cross-functional team with Product, Engineering, Medical, User Research, and Design, you'll turn user needs into intuitive, practical solutions, validate them with users and data, and bring them to life. This role is ideal for a designer who enjoys simplifying complex workflows, is passionate about educational and medical UX, and is excited to explore how AI can enhance both learning and the design process. You will report to the Director of UX Design. You will: Design and improve the end-to-end exam preparation experience for medical students and professionals in Germany, the United States, and international and adjacent healthcare markets across desktop and mobile. Work as part of the Qbank Experience Team, collaborating closely with Product, Engineering, Medical, Research, and Design to understand user needs and turn them into thoughtful product experiences. Take ownership of assigned design problems and projects, from understanding the problem and exploring concepts through prototyping, validation, detailed design, and implementation. Design and prototype learning experiences that help users practice effectively, reinforce knowledge, and prepare confidently for professional exams. Use qualitative and quantitative insights to inform your design decisions, working with our in-house User Research and Data teams to understand user behavior, validate solutions, and iterate on your designs. Collaborate with medical experts and editors to understand the needs of our highly knowledgeable users and translate complex medical and educational requirements into simple, intuitive experiences. Work closely with engineers throughout the design and implementation process to ensure that shipped experiences reflect the design intent while taking technical opportunities and constraints into account. Collaborate with other product teams to help create a cohesive and personalized user experience across relevant parts of AMBOSS, such as sign-up, dashboard, shop, and user profile. Apply and advocate for strong design principles, usability, and accessibility, contributing to high-quality and consistent experiences across AMBOSS. Contribute to the wider AMBOSS Design community through design critiques, knowledge sharing, and contributions to our design system, interaction patterns, and other shared design topics. Build a deep understanding of our users and advocate for their needs throughout the product development process. You bring: 3+ years of professional experience in UX or product design, with strong skills in information architecture and communicating complex information clearly and concisely. Strong user-centered design skills, attention to detail, and a solid understanding of UX and visual design fundamentals. Proficiency in Figma and modern prototyping tools, with an interest in using AI tools to support and improve the design process. Ability to work through design challenges and translate complexity into simple, intuitive, scalable and user-friendly experiences. A passion for creating great user experiences and for validating and iterating on designs to ensure they address user needs. Ability to translate product goals and user needs into thoughtful design solutions, from early concepts through to implementation details. A collaborative and iterative approach to design, with openness to feedback and working closely with others. A growth mindset and interest in developing a deep understanding of educational UX for a product designed for medical experts rather than a general audience. Experience using research insights and data to inform design decisions and participating in user research studies. Experience working effectively in cross-functional teams, including product, design, engineering, and research, and collaborating with a range of stakeholders. You enjoy: Digging into complex UX problems and experimenting to find simple, effective solutions for users. Working collaboratively with Product, Engineering, Medical, Research, plus commercial teams, rather than designing in isolation. Using research, data, and feedback to challenge assumptions and improve your designs. Moving from early concepts to detailed interaction and UI design. Learning about complex domains and developing empathy for highly knowledgeable, specialist users. Design systems and contributing to it Giving and receiving constructive design feedback and learning from other designers. Exploring new tools and ways of working, including AI, and thoughtfully applying them to your design process. Benefits: 🌴 Rest & Time Off (30 paid vacation days, AMBOSS holiday, personal purpose day and more) 🥙Food & Office Comfort ( Daily healthy breakfast & lunch by in-house chef in Berlin HQ, AMBOSS daycare, work remotely from other office spaces in Cologne, Sardinia, Cape Town) 🏃 Health, Fitness & Mobility (Urban Sports Club -M plan- , Fitbit Versa 3, Deutschland Ticket…) Check out the full list of benefits below: https://go.amboss.com/the-amboss-prescription-de We believe that diversity is a powerful driver of innovation and progress. That's why we are committed to fostering an inclusive, respectful, and supportive environment where everyone—regardless of gender, age, ethnic or cultural background, religion, disability, sexual orientation, gender identity—is valued and given equal opportunity to thrive. We warmly welcome people of all backgrounds to help us fulfil our mission: empowering all medical professionals to provide the best possible care 🩺 Even if you don't meet every single point in the job description, we still encourage you to apply. We'd love to hear from you! Find Jobs in Germany on Arbeitnow

View Job
UI Developer - Digital Products
NEW

UI Developer - Digital Products

FractalTexas, United Statesyesterday
Full TimeOn-siteJunior$120,000 - $130,000 / Year
javascriptreactangularvuefigmasketch+8

It's fun to work in a company where people truly BELIEVE in what they are doing! We're committed to bringing passion and customer focus to the business. Fractal is a strategic AI partner to Fortune 500 companies with a vision to power every human decision in the enterprise. Fractal is building a world where individual choices, freedom, and diversity are the greatest assets; an ecosystem where human imagination is at the heart of every decision. Where no possibility is written off, only challenged to get better. We believe that a true Fractalite is the one who empowers imagination with intelligence. Fractal has been featured as a Great Place to Work by The Economic Times in partnership with the Great Place to Work® Institute and recognized as a 'Cool Vendor' and a 'Vendor to Watch' by Gartner. Role Overview We are seeking an experienced UI Developer to translate design concepts into functional, visually appealing, and user-friendly interfaces. This role requires a strong blend of technical proficiency in front-end development and an understanding of design principles. Location: [San Antonio/ Dallas] Primary Focus: Front-End Development & Design Implementation Proficiency in Front-End Technologies A deep understanding and practical experience with HTML, CSS, and JavaScript are fundamental. These are the building blocks for creating web interfaces. Front-End Frameworks and Libraries Experience with modern JavaScript frameworks and libraries such as React, Angular, or Vue.js is often required, as they streamline development and enhance interactivity. Responsive Design The ability to create interfaces that adapt seamlessly across various devices and screen sizes (desktops, tablets, mobile) is crucial. Cross-Browser Compatibility Ensuring that the developed interfaces function correctly and consistently across different web browsers. Version Control Familiarity with version control systems like Git for collaborative development and code management. UI Development Tools Experience with design tools (e.g., Figma, Sketch, Adobe XD) to interpret and work with design mockups and prototypes. Key Responsibilities Translating Designs into Functional Code The primary responsibility is to accurately convert UI/UX designs, wireframes, and mockups into functional code, ensuring visual fidelity and interactive elements match the design specifications. User-Centric Design Principles An understanding of user behavior, user-centered design, and usability best practices to create interfaces that are intuitive and enhance the user experience. Visual Design Acumen While not the primary designer, UI Developers need an eye for design to ensure the implementation is aesthetically pleasing, paying attention to layout, typography, and color. Accessibility Implementing designs according to accessibility standards (e.g., WCAG) to ensure the application is usable by everyone. Collaboration with Designers and Developers Working closely with UI/UX designers to understand requirements, provide technical feedback, and with back-end developers for seamless integration. Communication Skills Effectively communicating technical concepts, design decisions, and potential issues to both technical and non-technical team members. Problem-Solving and Debugging Identifying, troubleshooting, and resolving technical issues and bugs within the user interface. Attention to Detail Meticulousness in coding and implementation to ensure pixel-perfect accuracy and consistency. Prototyping Ability to create prototypes to test and demonstrate UI elements and interactions. Required Qualifications Proficiency in HTML, CSS, and JavaScript Experience with modern JavaScript frameworks and libraries (React, Angular, Vue.js) Responsive design expertise across devices and screen sizes Cross-browser compatibility knowledge Familiarity with version control systems (Git) Experience with UI development tools (Figma, Sketch, Adobe XD) Understanding of accessibility standards (WCAG) Strong communication and collaboration skills Problem-solving and debugging abilities Attention to detail for pixel-perfect accuracy Preferred Qualifications Portfolio demonstrating UI development work Experience with design systems Track record in fintech, insurance, or member-facing digital products Pay The wage range for this role takes into account the wide range of factors that are considered in making compensation decisions including but not limited to skill sets; experience and training; licensure and certifications; and other business and organizational needs. The disclosed range estimate has not been adjusted for the applicable geographic differential associated with the location at which the position may be filled. At Fractal, it is not typical for an individual to be hired at or near the top of the range for their role and compensation decisions are dependent on the facts and circumstances of each case. A reasonable estimate of the current range is: $120,000 - $130,000. In addition, you may be eligible for a discretionary bonus for the current performance period. Benefits As a full-time employee of the company or as an hourly employee working more than 30 hours per week, you will be eligible to participate in the health, dental, vision, life insurance, and disability plans in accordance with the plan documents, which may be amended from time to time. You will be eligible for benefits on the first day of Employment with the Company. In addition, you are eligible to participate in the Company 401(k) Plan after 30 days of employment, in accordance with the applicable plan terms. The Company provides 11 paid holidays and 12 weeks of Parental Leave. We also follow a "free time" PTO policy, allowing you the flexibility to take the time needed for either sick time or vacation. Fractal provides equal employment opportunities to all employees and applicants for employment and prohibits discrimination and harassment of any type without regard to race, color, religion, age, sex, national origin, disability status, genetics, protected veteran status, sexual orientation, gender identity or expression, or any other characteristic protected by federal, state or local laws. If you like wild growth and working with happy, enthusiastic over-achievers, you'll enjoy your career with us! Not the right fit? Let us know you're interested in a future opportunity by clicking Introduce Yourself in the top-right corner of the page or create an account to set up email alerts as new job postings become available that meet your interest!

View Job
Brand Marketing Lead
NEW

Brand Marketing Lead

KittlBerlin, Germanyyesterday
Full TimeOn-siteLead
gofigmarestpartnershipslearning & developmentl&d

A little about us AI-native design: Kittl is becoming the AI-native, operating system for creative businesses. We give small brands the creative firepower to look credible and get from idea to launch-ready, with no agency and no design team Rapid growth: 11 million users since 2022 Diverse team: 120+ people from 30+ countries, with offices in Berlin and Düsseldorf and teammates working remotely Truly product-led company: Engineers, Product Managers and Designers sit at the core of what we build Strong backing: Raised over $50M, led by IVP with Left Lane Capital and Speedinvest. IVP has also backed Figma, Slack, and Dropbox Learn more: www.kittl.com/career Your role at Kittl Kittl's marketing is conversion-led - great at driving performance, but no one owns what Kittl is like, how it makes people feel, or whether our target audience has even heard of us. We need someone who can write the line that makes a founder feel seen, and who's restless about getting Kittl in front of that founder in the first place - through ideas bold enough to actually cut through. This works alongside our design lead, who owns visual identity. This role owns voice, story, and standing out. This role is for you if You have a gift for language - you notice when a sentence is doing real work versus just filling space You get restless with "safe" - you'd rather pitch the slightly-crazy activation that gets talked about than the tenth version of a banner ad You think about audience obsessively - not just what to say, but where our founders actually are, and how to show up there in a way that sticks You notice the thing everyone else scrolled past - the landing page headline that's almost right, the caption that undersells the idea, the touchpoint nobody double-checked You can't walk past something that's almost good enough - you stop, look again, and fix it before it ships You've spent time at an agency or in a fast-moving creative environment - you know how to move from a wild idea to something that actually ships You are both creative and strategic - you can go bananas with ideas ,and just as readily hold the line on what keeps them on-brand What you'll do Define and codify Kittl's voice and tone - then write the work yourself (manifesto, campaign copy, landing pages, launch narratives) at a level others can point to as the standard Dream up and lead brand activations, stunts, and campaigns designed to get Kittl in front of small business founders and make them actually care - concept through delivery Represent brand thinking in leadership and strategy conversations , pushing back where decisions threaten brand consistency/integrity Find and pitch unconventional ways to build awareness - partnerships, community moments, founder-facing events, anything that gets us known beyond our existing paid and influencer channels Bring bold, sometimes "crazy" ad concepts to growth/performance marketing - and know how to make them convert, not just turn heads Guide teams early - in briefs and reviews - so tone and ambition are right from the start, not fixed after Audit our messaging and presence across our touch-points (website, landing pages, ad/video scripts, campaign concepts, brand activations), ensuring excellence and consistency in all Who you are 5+ years (into your career - sharp instincts, real experience, not yet coasting on a title) Agency background, ideally 2–3 years at a creative/brand agency followed by in-house brand experience at a startup or fast-growing company Background in FMCG, DTC, or consumer goods brands is a strong plus Comfortable being the lone brand voice in a growth-led org - you can push for ambition without being precious Used to operating with real autonomy - comfortable figuring things out without a big team or a heavy approval chain Social media or community-building experience is a plus Show us, don't tell us Portfolio: Send 3–5 pieces of writing, campaigns, or activation concepts you're genuinely proud of Interview process Recruiter interview (30 min) Hiring Manager interview (45 min) Case Study interview (60 min) Bar Raiser interview (45 min) You'll do well here if You pick up problems nobody assigned you. If something's broken and no one has stepped up, you're the person who does You'd rather make the call and adjust than wait until you're certain. Velocity is the only advantage that can't be copied You want to own a domain deeply enough that people rely on your judgement in it, whether or not you manage anyone You'll argue for your position and commit fully when the call goes the other way You care about details other people would call excessive. Our standards are higher than most people think is reasonable, on purpose You use AI constantly and still own every word you ship It's probably not the right fit if You need consensus before you move You'd rather specialise narrowly than own a whole problem end to end You find it draining to have your thinking challenged in the open. We do that a lot, and it's sometimes uncomfortable Every new hire should raise the bar in some meaningful way, not just fill a seat. We hold to that, and it's why you'll be working with the most talented people from all over the world. Benefits Maximise your impact: Real ownership of what you ship. Whether you lead a team or lead through craft, we back you to do the work that matters most Shape AI-native creative work: Kittl sits where AI, design, and commerce meet. You'll build the tools that decide what professional looks like for our next million users AI enablement: We use AI across the company, not just in the product Passionate team: Quarterly hackathons for experimenting with new concepts, pushing boundaries, and delivering the next big thing Kittl Week: Each year, our global team gathers for a whole week, to work, celebrate, get inspired, and have fun Work-life balance: 30 vacation days a year, plus public holidays Flexible hours: Core hours are 11am to 5pm CET. How you build the rest of your day is up to you Hybrid working style: 3 days a week in our office in the heart of Prenzlauer Berg, the rest of the week from home Remote work: On top of that, work from anywhere in the world for up to 50 days (10 weeks) a year, as long as you're reachable during core hours VESOP: Enrollment in our Virtual Employee Stock Option Plan. When Kittl grows in value, you share in it Lunch: Daily chef-prepared meals in the office. Mobility: Your monthly BVG ticket, fully covered Health & fitness: Urban Sports Club M membership Learning & development: Annual L&D budget for your professional growth German classes: Online group courses at every level 🌈 At Kittl, we embrace diversity and value every team member's unique background, identity, and experience. We're all about respect, honesty, and inclusivity. Together, we create a safe and supportive work environment where everyone thrives. Join us on this exciting journey of making our company and product even better! Find more English Speaking Jobs in Germany on Arbeitnow

View Job

Page 1 of 116